Arizer argo reddit. Rogue hits heavier then the other two easily.
Arizer argo reddit Get the Reddit app Scan this QR code to download the app now. Arizer ArGo Video. arizer go (Argo) tutorial and review! i think the argo is a great vape for its size (maybe the best small sized electronic vape), i wouldnt buy it if i wouldnt care for the size and stealth , you can get better vapes that have all of his other unique qualities. The Argo is very reliant on how you pack the bowl, and the stem having a carb hole means no having to get the "perfect pack" to vape. The Argo gets it as well? Wow my solo 2 got it but arizer warranty kicked in and resolved it. If portability is a major factor for you, go for the ArGo. Furna didn’t produce much vapor. Mar 28, 2024 ยท The Arizer Go (visit store, use TVG20 to get 20% discount) or known by its moniker: ArGo, is a dry herb vaporizer created by Canadian manufacturer Arizer. ArGo Package ArGo Box. 4K subscribers in the VaporizaBrasil community. 231K subscribers in the vaporents community. 2: I am a solo user. It seems really great so far, but it seems to have a strange issue with the charging indicator. The solo 2 is the top dog on your list. The Lobo is a really good choice as it’s almost the same size as the ArGo (just slightly fatter), but packs much more of a punch. Reply firesmacker • If your looking for something that hits hard I would go with the crafty plus. The TM2 a nice experience but If price is a factor, there are less pricey vapes that will be a major improvement over the Argo. The air max has decidedly denser clouds and heats up faster so between the two I think the air max fits your needs better. When I turn my Argo on and use it for probably 3-4 mins the screen beeps and gives a "error5", then turns off. ArGo can stretch a session to 10 min, but the Lobo will be done in 5 min or less. You honestly don't even need the extra battery. I like the shape and design of argo but it's been out ages. I haven’t used an ArGo but having used the other Arizer vapes, and also a Furna; I’d suggest the ArGo out of the two hands down. First time using a vaporizer, old time gal here always smoked it. On a friends advice I start at 200 C (392 F) and take a few slow deep puffs before increasing in 5 C increments before reaching 220 C (428 F). the thing does heat up and the vapor gets hot. After lots of research, I've got my eye on the Arizer ArGo. The Argo is more of the same but more compact and removable battery. Keeps up with fast / strong inhales as well & mine survived a drop (beyond the stem) down half a flight of stairs onto hard floor with a minor dent. So back to the question. It uses 18650 batteries like the ArGo. Doesn't matter if you put 0. Flavor and maintenance is better on the ArGo, but the Firewood 7 has better vapor overall. At the moment i use a Bong and the Arizer ArGo vape, but in feel like it’s not getting me as stoned as a bong would. Here is what I've tried thus far: I have finely ground the herb I have rough-ground the herb I never liked the Air, found it too weak but way more portable. It has a discharge rate of 8A-9A continuous or something. seems to be the same type of oven and stem but a bit smaller than the Air/Solo. [Review] Arizer ArGo. I bought a solo for $124. That being said it's an amazing vape. The Firewood 7 is another option. 2, the Rogue will get you high. Arizer is solid, they've been around forever and make reliable products that require less cleaning maintenance than any other devices out there. 205C (401F) Arizer Argo bong rips. Such as the Solo 3 that Electrokho has mentioned as an example. Its battery charge always lasts longer than expected. Haven’t had that problem with the air 2, I do use it less though but i have noticed that it gets more dust particles inside the screen. 2V when fully charged. 2 year warranty, 26650 Battery, stainless steel body, Digital control, dark mode, display inversion, 14mm WPA & 70mm Stock Stem, USB-C in Air MAX. Hi. I can't seem to find super long stems like are available for the Air/solo, so I'm looking at a normal long stem. 1g-0. At the time of writing, the Arizer Solo II retails for $135 , which puts it in a lower price bracket compared to other portables I have reviewed such as the Airvape Legacy Pro ($269) and I have the Argo and used to have the OG Solo and Solo 2. What would be the Posted by u/jabnroll - 1 vote and 4 comments After 120 days of using stock air max i orderd the glass aroma tube/stem tipped version by Arizer. Locked post. Use coupon code VAPEWIZ20 to save 20%. If I want to get baked with the arizer I repack the air max once within a 15 min session and that capacity is 0. Press inward also when locking it. The IQ has a respectable chamber (. Clean air path, nice flavor. The Fury edge is also recommend only with the WPA or 3d flow Stem. I was intrigued as to what others do with thier heating tempretures. You can get the Arizer Air II from PotV for $195 with the coupon code AIRII35 which makes it about $60 cheaper than the ArGo if that makes a difference for you. First smoke of a new strain is always with the ArGo. I've broken one stem, and that's because it rolled off my desk I love my Argo, but if you want big, cloudy hits it's not the vape for you. Maybe try giving it a longer and slower pull for the first one in a new bowl. Solo 2 is better overall unless you need a discreet portable or the ability to use 18650 rechargeables. 99 CAD plus applicable taxes an Arizer Solo II unit & charger (no accessories) for $144. Reply reply I’ll tell you the difference between the air and the Argo. The main differences between the solo and the Argo is size and battery. Now, however, I'd like to get another vape, most probably an Arizer again since I loved the vapor so much and its ease of use and maintenance. No problem, I initially had the same problem with my Arizer Air. I bought my ArGo a couple months ago. I grabbed it outta the water within a second (it was clean water) and I popped out the battery and started shaking the unit until no water came out. This takes the stress off the mechanism & will ideally get you a much longer life on that part & new ArGo. Reddit's largest community focusing on cannabis flower vaporizers I will mainly be using it for at home vaping but sometimes would like to use it while going out to a party. Reddit's largest community focusing on cannabis flower vaporizers. My only con really is that it's due for an update. Capsules are super convenient - the Argo stems are expensive and not pocket friendly - The high is more intense - almost like a dynavap - Versatility of the vape is amazing. Or check it out in the app stores ๐๏ธ BackSpacer for Arizer Solo2/Air2 & ArGo Share Sort by But now am stoked about getting another different one. I have an Argo and a POTV one. I've had the solo, solo2, and now argo. Hey - hoping to get some advice or a potential solution Completely accidentally just discovered the OFFSET setting on my ArGo and I moved it up/down a few times I think as I wasn’t sure what it was; pressed the buttons by mistake and thought it was the normal menu before realising I’d never seen it before and hitting Google ๐ First time buyer here looking for some advice. Loading the stems is easy but the stock stems aren’t as good as 3rd party cooling ones. I'm a big fan of Arizer stuff, think it's the best value company. Reddit's largest community focusing on cannabis flower vaporizers In the 'bang for the buck' department, the Argo is outvalued by the Fury 2. I wouldn't want to pay over $100 for one today. It’s also super easy to clean and maintain, the glass pathway is awesome, and overall it’s just a great vape. Please definitely leave your suggestions if you have any. Deffo want arizer, replaceable battery and easy cleaning (really struggle taking the mighty apart, getting o rings off due to weakness /lack of dexterity in hands). Oh without a doubt, same ease of cleaning you get with the ArGo but a nicer experience in pretty much every way. So I just bought the Arizer Go. In the hand though, they're in a different class. Or should I say, all three of them. my experiences with cartridges. Argo has removable battery so you can buy another one and increase use time. If you enjoy flavor, I think the arizer systems are better than the crafty/mighty. Arizer Air/Solo/Argo are session vapes and it takes about 12 to 20 minutes to extract a bowl while a Dynavap is on-demand and you clear the (smaller) bowl in 3 hits. After researching it seems like the Arizer Argo is a good one. ADMIN MOD Arizer ArGo with hash? Hey! I'm considering buying my Depends on your budget and what kind of vape you want but the portable ones I hear the most about are the firewood 7 and tinymight. 10-12 minutes sessions is too much for me to get where I want. Argo has much smaller stems, both in length and diameter. Now if I'm using with the bong only really works cranked all the way to 428*. Beginner I’ve been Build quality is up to Arizer standards, no complaints from me there. A bit technical stuff : 18650 just a form factor, 18mm ∅ and 65mm long Li-Ion can explode once pierced or overheated. Argo is nice. It's super portable, replaceable battery, uses a hybrid of conduction and convection heating, less restrictive airflow compared to other Arizer portable vapes, ceramic heater, discreet, easy to load and even easier to maintain. This isn’t an ad but I had such an incredible customer service experience that I would highly recommend trying them. I am moving into an apartment so need stealth as my main priority. I don't really remember arizer ever having the public beta test their products or sending out freebees for reviwers that's why we never know anything new was coming out (except they did tease for a bit before the Solo 2). I turn it back on and then it's fine again. I'd like to know how do you feel using the Argo compared to Dynavap M? I’ve got an OG Mighty, Tinymight 2, Volcano hybrid and Dynavap but there’s just something about the way Arizer’s taste that made me want to get another one, my first vape was the Arizer Exteme Q which in my opinion is the best price to quality ratio vape on the market with the fan assisted whip and I’ve missed it ever since i gave it haven't tried the Argo but I've had a couple of Arizer Solo 2s and I honestly think they are brilliant. Featuring an all-glass pathway for the vapor, a removable 18650 battery and a ton of impressive specs, the ArGo is a serious contender! The ArGo is the latest release from the Canadian vape company Arizer. The Arizer Go is very good at what it does. I do feel like the air flow is a little more open on the newer XL stems. I love my Argo because it has a swappable battery but the solo 2 battery will destroy the POTV one’s So I just got my ArGo like two days ago, it slipped out my pocket as I was about to sit on the toilet. 4 days ago ยท The ArGo vaporizer remembers the last temperature used, and proposes 1-degree increment and 10-degree increments to speed things up. I do get uneven roast on the XL stems but it isn't bad by any means. 3. 10% off code works with the chargers. I have dynavaps and I have an arizer v tower whip vape at home too which rips with the ddave mod i dont really need another herb vape thats less portable and may finish my sesh a little quicker (got the argo for long car rides tbh). haven't tried it yet, right around 370F has always been my temp. Edit: the Davinci is not even in the same league as the Arizer vapes you listed don’t even consider. All arizer portables use a hot surface (oven/glass stem) to extract, not hot air. Taking quick, rapid-extraction hits for rapid-onset of effects is not an option. You must take slow, long draws. The ArGo doesn’t belong in the same category as the other vapes listed. Yea it should be fine. Reddit's largest community focusing on cannabis flower vaporizers! Can’t say much about desktop vapes but my ArGo has lasted 4 years so far. I was wondering if anyone had an idea for an easy repair option? Hey there - both are on sale today as part of the black friday deals. Now I have medical so can vape good quality and have healthier choices instead of smoking. Reddit's largest community focusing on cannabis flower vaporizers Members Online • Sidhart2Go. Hello Vaporents, I recently dropped my vape and broke this small plastic latch that holds the battery cover in place. I find the draw tight (like a milkshake) on the argo and was just wondering how it is on the Mighty? Also I love the taste of Arizer vapes but haven’t really tried another product in a similar or higher class. For the Argo, I think it's too harsh with the stock stem as well and the WPA was kinda ehhh. I start at 185*, then go up 10* at a time to 405*. You could get the water pipe adapter (wpa) off Sneaky Pete and buy a small bong off DHGate or one of Petes bongs. I have an arizer solo 2 and I keep it at 374f. I was in a thread earlier were some guys were saying closer to 350 gives you amazing draws. You can see from the pics that they don't actually fit in the glass stem, but you can just drop one down into the oven and sit the stem on top. I enjoy the argo I use it more than my splinter, the vapor is very smooth and flavorful, I also think the amount of cloud you get depends on how you inhale, personally the way I inhale is if I am breathing in the vapor rather than sucking in the vapor, a slow steady deep inhale seems to provide more vapor and a stronger hit compared to Long extraction times hinders the flexibility of how you use the vape. Argo is so good because i can have it in my pocket and just forget about it. Premium Powerups [Review] Arizer Argo Teardown. ADMIN MOD POTV Lobo or Arizer ArGo or Solo 2 . If you mostly smoke alone get the Argo it is smaller and has amazing battery life. Hello all, I have just ordered an Argo as well as a bubbler stem (I know some people don't like it, but I defiantly want to try one) and am wondering about extended/cooling stems. Holding about ~0. Rogue hits heavier then the other two easily. I Say ArGo. Having an open draw or less draw resistance has nothing to do with convection heating. It was originally between that, an Argo and a Fury 2 but eventually my purchase was whittled down to being a choice between the Solo 2 and a Storz & Bickel Mighty. Own a crafty+. Anyone know what they… The Solo II seems to be more popular, but they both seem very similar with the argo being slightly cheaper (~135$ vs 120) but with worse battery/slightly slower heating. New comments cannot be posted. Reddit's largest community focusing on cannabis flower vaporizers Reddit's largest community focusing on cannabis flower vaporizers Members Online • dfails16. I think the v-tower is $169. It’s a powerful battery and the ArGo doesnt take that much current. I would like something portable, easy to use, and I would be… Arizer ArGo questions and recommendations : r/vaporents - Reddit true Reddit's largest community focusing on cannabis flower vaporizers Members Online • [deleted] ADMIN MOD Taking apart arizer argo pop up . One goes up to 10 (not 11 ๐) and the other guys up to 8. Has any Argo users bought an additional battery which is not from Arizer? I just ordered a Panasonic 18650 3400mAh battery, but just understood it's 3. I attached a water pipe to the end of the silicone whip and haven't ever used the tower without it. The only thing I didn’t like was the time. I keep a couple of small Bernadine glass jars filled half way with ISO 99%. I have arizer and dynavap vapes, they're different animals and quite complementary in my opinion. Reddit's largest community focusing on cannabis flower vaporizers Members Online • beamoflight42. 229K subscribers in the vaporents community. Arizer is well I have the edge and love it. 05 or 0. Arizer is also the maker of a few famed desktop vapes on the market, such as the V Tower and Extreme XQ ( review ). Arizer ArGo Arizer Air Max Arizer Solo 3 TM2 Crafty+ Mighty POTV Lobo I know that's a huge price range. I find the glass tubes really easy to clean, fill and look after, and a really nice vape with good battery life and temp control. Since there are newer versions of the Air and Solo, and because I ran out of poll options, I put them in the same slot. ArGo - smaller, removable battery, tastier flavor, easier temp control. The caps keep it squeaky clean. Of your options, I'd select Solo2 only cuz I never tried the Argo. The solo has an internal pack and will need to be recharged. 7V and 4. The one consistent point I seem to find about it online is that vapor production is fairly mediocre compared to the other Arizer products. If you want a smooth sipper that is discrete and pocketable and great for night time walks on the weekend with the dog, the Argo is great. Micro USB and slower than most new devices to heat up (60-90 seconds or so). The two biggest and very important factors that out the Argo over the Fury is the vapor quality, which I think the Fury 2 is subpar, and the Argo has replaceable batteries. Arizer is great. After looking through a lot of threads, it seems there are way better choices than the Pax 3 at a similar price-point. I'm between air max and argo. The IQ is full conduction and the ArGo is more hybrid, so extraction will be a bit better. 16 votes, 14 comments. You might be going a little high in temp. On the other hand Argo: Has no silicone parts, so the flavour is better Uses external batteries Someone has linked to this thread from another place on reddit: [r/amaaggregator] Arizer ArGo Review + AMA About It If you follow any of the above links, please respect the rules of reddit and don't vote in the other threads. Actually didn't use it for a significant amount of time because it burned my lips with miniscule amounts of vapor, then I figured out for all the years I've been smoking weed that I've been more or less inhaling wrong with everything haha. I had the Arizer solo for a long time so I am leaning towards the Argo, just wanted to get some thoughts from owners of either. It's a rebrand of a healthy rips vape, yes? I think the main downside of the One for me, and plus for the Argo, is replaceable batteries. Arizer EQ user - a full (stock) bag is pretty killer for one person, right? I feel the need to opt out for a few mins, compared to spliffs which I used to hit back to back. The original ArGo battery is a Samsung 35E 3500mAh 18650. In the last 2 years, I went from the Argo, to the Rogue, to the TinyMight. I thought it was a flaw of the Argo for a while before I realized I was always packing too tightly and letting my stems (and especially those few holes) get clogged. Wow. Side note: I know this is the OCS group but I actually ordered the ArGo from Puff It Up. These are the same guys who brought us the Solo The Arizer portables are known for their intense flavor due to all glass vaporpath. (Info / ^Contact) I have an arizer argo. Reddit's largest community focusing on cannabis flower vaporizers! Dry-herb vaporizers heat cannabis flower to a point where its active compounds are aerosolised and can be inhaled, but there is no smoke or combustion! The ArGo gets the most use because of the Ux (portable, pocketable, can load up extra tubes for quick reloads on the go) but it’s not a heavy hitter. I actually have been enjoying it more. Device heat: Rogue is clear winner here. Just received my ArGo vaporizer from PuffItUp. Hey, I'm new to this subreddit and I figured this would be a good place to ask about an issue I've had with my Arizer ArGo. This is important if you are sharing the vape with others in your sessions. It was off. Even if/when you do upgrade, it's still worth holding onto the Argo to be a connoisseur when tasting new/different strains. I preferred my Solo 2 over the Crafty and the ArGo is a shrunken down Solo 2 I soak mine in alcohol baths. I haven't bought another vape since then (I'm more of an irregular smoker / vaper). Reddit's largest community focusing on cannabis flower vaporizers Discussion I bought an Arizer Argo a few years back, but no longer use it. Its BOGO FREE AIR. 99 and got the arizer air for free. I did not find the need to microdose with the ArGo because the chamber was already small and thin, unmodified. Comunidade criada em prol da redução de danos, compartilhamento de relatos, reviews, dúvidas e…. One jar is to soak the stems. Plus the included WPA is a really nice touch. Read on below to check out my full Arizer ArGo vaporizer review. The Arizer is designed and refined, polished and perfected. Hits the weakest of the bunch. What the title says. I can not compare to an Argo, but the top two portables from Arizer that I own are the Solo(second place) and Solo2(first place). I don't like the heat on my throat above there. I have tried temperatures as low as 350° F all the way up to 405° F - with no notable difference. Reddit's largest community focusing on cannabis flower vaporizers It's hands down the best Arizer portable right now. If you are going for vapor quality, the mighty. Overall I'm very happy, but then I knew I would be happy. I'd love to stay towards the lower end but again, if it's worth the upgrade it's worth the upgrade. My research has boiled down to these two vaporizers. Smell is pretty similar between the ArGo and Firewood 7. I feel I will primarily be using this at home, so battery life shouldnt be too big of an issue for me. How is the taste in comparison on a a mighty? I’m also worried about cleaning being more of a headache on mighty vs Arizer products. How old was your Argo? I love my Arizer Solo 2, but it's kind of hard to take it out on trips without some sort of case for it unless you want to carry glass tubes in your pockets. Hey, I'm in the market for a new portable vape and am really liking the idea of the ARGO but I've never actually talked to someone who has used one before. Air Max would be my choice over the ArGo every time. Reddit's largest community focusing on cannabis flower vaporizers! Dry-herb vaporizers heat cannabis flower to a point where its active compounds are aerosolised and can be inhaled, but there is no smoke or combustion! Has anyone else experienced their Arizer Argo cracking all over the plastic? Not just the battery hinge but all over the lower part of the body. You definitely won't have to worry about attracting attention because of huge clouds. Battery: Argo around 45 mintes, Rogues around 80 mins (depends on temp). 13 votes, 14 comments. Solo being the biggest, Argo the smallest. I have a stempod si which is a bit different because it's a 510 connection that works with a box mod but goddamn I love it, it's so versatile and it was less expensive than the former ones I mentioned. Never tried the Argo, but it seems slightly more portable than the Air. Short 60-sec on-demand sessions are not an option. I used to by very happy with my og Arizer Air until it stopped working 2 years ago (after 7 years or so). the air has a bigger bowl. 245K subscribers in the vaporents community. I’ve bumped it over maybe a couple of times when it’s sitting upright on the coffee table, but nothing substantial so it seems like a lot of damage for pretty normal use. The ArGo stems are the perfect loading tool to fill the Firewood 7. Going to purchase the Arizer Argo shortly, any tips, things I should know, or anything of that sort? Thanks! For this reason, I was excited to review the Arizer Solo II which is one of their three portable offerings, apart from the Arizer ArGo and Arizer Air MAX. 2g I can decrease the herb chamber capacity by shaping a screen into a dome shape and insert them into the stem, all the way to the glass screen and then pack herb on top of it. It does work well with concentrates though. Free shipping over $50 purchase. I wouldn’t consider it as a portable for outside the house so my ArGo still sees tons of use but I would one hundred percent choose to buy the air max as an around the house portable without a question. The Argo operates off 18650 batteries, as does the air, which I believe is what one gets with the bogo. I like em. 2 so seems like I am using roughly the same amount of flower per device, but I feel like I'm higher after using the air max. It's definitely flower/packing dependent on how each sesh will be. You can get more than 2 bowls out of the Argo battery, but 7-8 bowls with the Rogue. Edit: thanks for the feedback so far, it's all very helpful. 1: I was surprised how tiny the receptacle was for the ground bud. Here are my thoughts. See full list on vaporizerwizard. I have been using an ArGo for a couple of months now and it is a great bit of kit. Fury 2 & Fury Edge dosing caps can be used in an Arizer Argo. I believe there are non-glass options in the aftermarket market. The screen spacing is a good call. Don’t make the same mistake as me and lose 4 minutes wondering why it’s blinking at 79 F ๐๐. 243K subscribers in the vaporents community. 240K subscribers in the vaporents community. A week ago I recommended my friend the Arizer Argo because he said he was tired… Air MAX or Air SE if you are looking for a portable. The guys at POTV mentioned when using the dosing capsules with the similar ONE vaporizer to up the temp by 10 degrees F and to remove the mouthpiece screen and gasket for better airflow. I do recommend the ultradry stem from 420EDC. ADMIN MOD Arizer ArGo v Pax 3 . 6v instead of 3. This is a place for those seeking advice and to share information, knowledge & news about legal medical cannabis obtained by a prescription as well as the clinics and pharmacies that provide it. The Argo is slightly slower with more draw resistance but arguably better flavour because of the all glass air path. Hits the hardest but not by much. Also, any resources/recommendations for learning how to actually use these things well is much appreciated. Yeah, and I’m not trying to talk you out of the Argo or anything like that, I just wanted to provide my perspective. When you get a new one, press inward on the door before you unlatch it. 3g iirc) but they have glass inserts to make the chamber smaller so you don’t have to pack so much in. For the first couple weeks it was fine, then it stopped reporting the battery percentage while charging. Discussion Confused as to which one Arizer also make great vapes, had solo 1, solo 2 and extreme q from them. Advertisement Coins. The Contact Arizer for warranty support. Fyi it voids your warranty using non arizer 18650. Buy an extra battery for it too, I'm glad I did. I fucking love my arizer air. 99 CAD plus applicable taxes The Argo is the only portable by Arizer that I do not have. com Aug 8, 2024 ยท The ArGo is priced in the medium to high price range for portables but I think you’ll find that it’s worth every penny. The ArGo vaporizer retails for $119 and you can click here to pick it up directly from Arizer. One thing I am concerned about is are you able to vape smaller quantities with the Argo if I don’t want to be too high? Reddit's largest community focusing on cannabis flower vaporizers. I’m hoping for some advice on my first dry vape purchase—Arizer Argo or Fury Edge. Rogue gets me there in half of that and TinyMight in a minute. I can already tell this is big difference. You will notice a huge difference as the Argo is pretty under powered comparatively speaking. Easy to clean but the draw resistance is a thick milkshake instead of free flowing. I’d like to get away from bongs as it’s unhealthy for your lungs etc etc. If time is not a problem for you, Argo might be a bit better that the Rogue taste wise. The air is not being heated before it reaches the oven, so there is little to no convection at work here. Have you broken argo stems? I only ask because I thought this would be a big problem for me, but I have used my argo heavily for almost 4 years and my device and stems have survived a lot of drops, being tossed around in my backpack, and all kinds of other abuse. The Fury 2 is cheaper and it extracts more quickly while still having really good vapor. Just a quick FYI, when you do start your ArGo up you gotta press the + or - otherwise it won’t start heating up. 7v that comes with the True, and it can also be mitigated by not packing tightly and making sure to clean the stems regularly so they don't gunk up. Recently got shown the world of dry-herb vaping from a friend who owns the Pax 3. When in the menu there are 2 sets of numbers. I think im losing less vapor and holding it in longer whcih gets me more high. We have cart level discounts on the PB2C & the Samsung 35E, throw the PB2C in your cart 1st & check your cart for the savings. 230K subscribers in the vaporents community. I let it charge to 100% with the included micro USB cord. Sneaky Pete has long Argo stems, those will cool the vapor temp down for sessions you don't want to use water pieces. My main concern with the solo 2 / argo is that the extraction time is fairly long and that it will probably not hit as hard. Battery lasts through at least 8-10 caps. Basic voltage of Li-ion is 3. Solo 2 heats up faster than the Argo, so would be better for quick sessions. 10JUN20 is the code. The One looks solid and it's pretty cheap right now. We can cover you on the official Arizer charger & we stock XTAR if you are looking for a more economical solution. The ArGo is slower extracting (solo 2 is faster) but much tastier. For example, with the ArGo: You must take 5-10 min sessions. My Arizer ArGo herb vape just isn't doing it for me, vs. However we should account for efficiency (more details below). I got a couple stems from 420edc (a wpa adapter, and a 3d curved one), but I am really looking for an even longer one to give more glass area for cooling down. I thought it would be 3asy to share but I always found it easier to pack the bowl at the joint instead of the actual cyclone bowl. Aug 11, 2020 ยท The Arizer ArGo (or Arizer Go) is an extremely compact, super stealthy dry herb vaporizer. an Arizer Solo II complete with accessories for $179. 99 CAD plus applicable taxes an ArGo complete with accessories for $179. 99 CAD plus applicable taxes an Arizer Air MAX complete with accessories for $264. I'm leaning more towards the TinyMight due to its multi function, the Argo due to the price and because I know first hand Arizer make decent products and finally the Mighty due to all the hype but also because I know, again first hand, that Storz and Bickel are dominant. 67 votes, 21 comments. 25 to . I much prefer the Solo2 to all of the other Arizer portable vapes. Super portable, slaps like hell out of a bong with the attachment. I bought the rogue to upgrade from a argo and when I had to send it in for replacement I bought the v3pro as a backup, after having all three for a while now including the replacement rogue I think the argo is better now then I did before, if I had to rank them as a keeper it’s rogue>argo>v3pro. 0 coins. Share 51 votes, 10 comments. Is the Argo OK to toss in your bag, or are the glass stems fragile? I like that the pax is just one piece, and I can pack it at home and be ready to go. Reddit's largest community focusing on cannabis flower vaporizers I have the Arizer Argo, but I find it super hard to get any meaningful clouds, and I only ever get a minor buzz. Please let me know if it’s worth it or if there is a better / cheaper alternative. They are cheaper than their newer counterparts and I thought the extreme q and V-Tower deserved their own slot, as I know nothing about the units. It's fun to make massive hits. Not as much battery life as you could get with their included 18650. Reddit's largest community focusing on cannabis flower vaporizers! Dry-herb… Fine if you come from smoking, but not after you’ve been used to the ArGo “full glass path” taste. Beginner I think I saw some So, thanks to you guys and alot of research I ended up settling on an Arizer Solo 2 back in early December. The Argo is my favorite for portability. Haven't tried the solo but the air max absolutely chugs compared to the argo, not the thickest vapour but definitely flavourful & amazing for lower temp vaping. I'd have to run a lot of caps to get to the same place that I'd be with a stem on the TM. Crafty is more powerful, larger bowl. The main issue with Arizer vapes in relation to portability is that glass stem. A very tasty, handy vape (as others here have said), but just not effective to getting me to "liftoff". The package came exactly on time, was very easy to track, and included stickers, candy and a free grinder. The temperature range goes from 122°F to 430°F (50°C to 220°C) and the device heats up in one minute, less for lower temperatures. There are some very strong opinions on arizer devices and I think for the right people they are great. Best flavor of all on your list. Reply reply arGo, Arizer 1, Arizer 2, Solo 1, Solo 2, Extreme Q, and V-Tower. The other is to bathe them after cleaning with Q-tips to remove any residual residue/debris. It is a powerhouse when it hits that point where its fully warmed up, takes about 4-5 mins. I went from a Pax to ArGo and I can definitely tell you it blows the Pax in every aspect except size. Both can extract well but the crafty has the better heater and extracts faster. It's a good vape, though being a session vape with a plastic airpath, doesn't get much use from me. It has 90% of the performance of arizer's bigger devices and still the easiest brand to clean/reload. Check out this video for an overview of the ArGo by Arizer. . They need a little bit more time to heat through but can confirm they work fine. I might be wrong as I am a complete noob with vaporizers. I used to have an Air OG until it broke a few weeks ago - I am a bit bias towards the argo for that reason but I also am not opposed to the V3 Pro if it is better on some level. If portability and discreteness are really important to you, then the Argo is probably your best bet, Cannabis prescriptions became legal in the UK in 2018. Reddit's largest community focusing on cannabis flower vaporizers! Dry-herb vaporizers heat cannabis flower to a point where its active compounds are aerosolised and can be inhaled, but there is no smoke or combustion! Hey guys, my friend doesn't use reddit so I'm posting this for him. this post isn’t 100% serious because I’m not too anal about people calling it the Arizer ArGo since the unit is just known as the ArGo, but the name literally is short for Arizer Go, as seen on the Arizer website and puffitup lol Got mine this week, love it so far (taste is back from good bud!) BUT. That’s a huge jump. Stems are not the same. idk it seemed like the herb always got sucked up into the top joint anyways I don't like the Arizer Solo or Air because the glass tube protrudes so much, which makes it vulnerable and difficult to carry, but the Argo doesn't… If you do buy it, get it from arizers website. Mighty is a good vape sure, but I reckon arizer are far better value. dbdodqvhrjtvndmidyeinvhlrecwqwfvasepvpdypcxokenwtbkjgie